General Information

  • ID:  hor001972
  • Uniprot ID:  P01286
  • Protein name:  Somatoliberin
  • Gene name:  GHRH
  • Organism:  Homo sapiens (Human)
  • Family:  Glucagon family
  • Source:  Human
  • Expression:  hypothalamus
  • Disease:  Diseases associated with GHRH include Acromegaly and Hypopituitarism.
  • Comments:  Used for the treatment of growth hormone deficiency
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016608 growth hormone-releasing hormone activity; GO:0031770 growth hormone-releasing hormone receptor binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007267 cell-cell signaling; GO:0008284 positive regulation of cell population proliferation; GO:0021984 adenohypophysis development; GO:0030252 growth hormone secretion; GO:0032094 response to food; GO:0032879 regulation of localization; GO:0035264 multicellular organism growth; GO:0040018 positive regulation of multicellular organism growth; GO:0043568 positive regulation of insulin-like growth factor receptor signaling pathway; GO:0046005 positive regulation of circadian sleep/wake cycle, REM sleep; GO:0046879 hormone secretion; GO:0046887 positive regulation of hormone secretion; GO:0060124 positive regulation of growth hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043195 terminal bouton; GO:0043204 perikaryon

Sequence Information

  • Sequence:  YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Length:  44(32-75)
  • Propeptide:  MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG
  • Signal peptide:  MPLWVFFFVILTLSNSSHCS
  • Modification:  T44 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts on the adenohypophyse to stimulate the secretion of growth hormone
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GHRHR
  • Target Unid:   Q02643
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01286-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001972_AF2.pdbhor001972_ESM.pdb

Physical Information

Mass: 580787 Formula: C215H357N71O67S
Absent amino acids: CHPW Common amino acids: R
pI: 10.91 Basic residues: 8
Polar residues: 12 Hydrophobic residues: 14
Hydrophobicity: -79.77 Boman Index: -13343
Half-Life / Aliphatic Index: 2.8 hour Aliphatic Index: 80
Instability Index: 3827.5 Extinction Coefficient cystines: 2980
Absorbance 280nm: 69.3

Literature

  • PubMed ID:  6812220
  • Title:  Growth hormone-releasing factor from a human pancreatic tumor that caused acromegaly.